| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | eIF2B3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The eIF2B3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to eIF2B3. This antibody reacts with human. The eIF2B3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human eIF2B3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QRDFIGVDSTGKRLLFMANEADLDEELVIKGSILQKHPRIRFHTGLVDAHLYCLKKYIVDFLMENGSITSIRSELIPYLVRKQFSSASSQQG |
|---|
| Other Names | EIF-2B, eIF-2B GDP-GTP exchange factor subunit gamma, EIF2Bgamma, eukaryotic translation initiation factor 2B, subunit 3 (gamma, 58kD), eukaryotic translation initiation factor 2B, subunit 3 gamma, 58kDa, translation initiation factor eIF-2B subunit gamma |
|---|
| Gene, Accession # | EIF2B3, Gene ID: 8891 |
|---|
| Catalog # | NBP1-83985 |
|---|
| Price | |
|---|
| Order / More Info | eIF2B3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23435261 |
|---|
| 产品资料 |
|
|