| 产品详情 |
| Edit |   |
| Antigenic Specificity | eIF2B4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The eIF2B4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to eIF2B4. This antibody reacts with human. The eIF2B4 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human eIF2B4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VGREMTKEEKLQLRKEKKQQKKKRKEEKGAEPETGSAVSAAQCQVGPTRELPESGIQLGTPREKVPAGRSKAELRAER |
| Other Names | DKFZp586J0119, EIF2B, EIF-2B, eIF-2B GDP-GTP exchange factor subunit delta, EIF2BD, EIF2Bdelta, eukaryotic translation initiation factor 2B, subunit 4 (delta, 67kD), eukaryotic translation initiation factor 2B, subunit 4 delta, 67kDa, translation initiation factor eIF-2b delta subunit, translation initiation factor eIF-2B subunit delta |
| Gene, Accession # | EIF2B4, Gene ID: 8890 |
| Catalog # | NBP2-58603 |
| Price | |
| Order / More Info | eIF2B4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|