| 产品详情 |
| Edit |   |
| Antigenic Specificity | EIF2 beta |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The EIF2 beta Antibody from Novus Biologicals is a rabbit polyclonal antibody to EIF2 beta. This antibody reacts with human. The EIF2 beta Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human EIF2 beta antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKK |
| Other Names | DKFZp686L18198, EIF2, EIF2B, eIF-2-beta, EIF2beta, eukaryotic initiation factor 2-beta, eukaryotic translation initiation factor 2 beta, eukaryotic translation initiation factor 2 subunit 2, Eukaryotic translation initiation factor 2 subunit beta, eukaryotic translation initiation factor 2, subunit 2 (beta, 38kD ), eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa, MGC8508 |
| Gene, Accession # | EIF2S2, Gene ID: 8894, Accession: P20042, SwissProt: P20042 |
| Catalog # | NBP2-38483 |
| Price | |
| Order / More Info | EIF2 beta Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|