| 产品详情 |
| Edit |   |
| Antigenic Specificity | EIF3C |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The EIF3C Antibody from Novus Biologicals is a rabbit polyclonal antibody to EIF3C. This antibody reacts with human. The EIF3C Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human EIF3C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YYKFDYKAHQRQLTPPEGSSKSEQDQAENEGEDSAVLMERLCKYIYAKDRTDRIRTCAILCHIYHHALHS |
| Other Names | cell migration-inducing protein 17, eIF3 p110, eIF3c, EIF3CL, eIF3-p110, EIF3S8FLJ55450, Eukaryotic translation initiation factor 3 subunit 8, eukaryotic translation initiation factor 3 subunit C, eukaryotic translation initiation factor 3, subunit 8 (110kD), eukaryotic translation initiation factor 3, subunit 8, 110kDa, eukaryotic translation initiation factor 3, subunit C, FLJ53378, FLJ54400, FLJ54404, FLJ55750, FLJ78287, MGC189737, MGC189744 |
| Gene, Accession # | EIF3C, Gene ID: 8663, Accession: Q99613 |
| Catalog # | NBP2-46741 |
| Price | |
| Order / More Info | EIF3C Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|