| Edit |   |
| Antigenic Specificity | RTP4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RTP4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RTP4. This antibody reacts with human. The RTP4 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human RTP4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: CSWSQYEMPEFSSDSTMRILSNLVQHILKKYYGNGTRKSPEMPVILEVSLEGSHDTANCEACTLGICG |
| Other Names | IFRG28receptor transporting protein 4, receptor (chemosensory) transporter protein 4,28kD interferon responsive protein, receptor transporter protein 4, receptor-transporting protein 4,28 kDa interferon-responsive protein |
| Gene, Accession # | RTP4, Gene ID: 64108, Accession: Q96DX8, SwissProt: Q96DX8 |
| Catalog # | NBP2-39040 |
| Price | |
| Order / More Info | RTP4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |