| Edit |   |
|---|
| Antigenic Specificity | RTP4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RTP4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RTP4. This antibody reacts with human. The RTP4 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to RTP4 (receptor (chemosensory) transporter protein 4) The peptide sequence was selected from the middle region of RTP4)(50ug). Peptide sequence SSDSTMRILSNLVQHILKKYYGNGTRKSPEMPVILEVSLEGSHDTANCEA. |
|---|
| Other Names | IFRG28receptor transporting protein 4, receptor (chemosensory) transporter protein 4,28kD interferon responsive protein, receptor transporter protein 4, receptor-transporting protein 4,28 kDa interferon-responsive protein |
|---|
| Gene, Accession # | RTP4, Gene ID: 64108, Accession: Q96DX8, SwissProt: Q96DX8 |
|---|
| Catalog # | NBP1-56448 |
|---|
| Price | |
|---|
| Order / More Info | RTP4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|