| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FRA2 |
|---|
| Clone | 2B2 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. It has been used for IHC-P. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FRA2 Antibody (2B2) from Novus Biologicals is a mouse monoclonal antibody to FRA2. This antibody reacts with human. The FRA2 Antibody (2B2) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | FOSL2 (NP_005244 207 a.a. - 296 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QPMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFYGEEPLHTPIVVTSTPAVTPGTSNLVFTYPSVLEQESPASP |
|---|
| Other Names | FOS-like antigen 2, fos-related antigen 2, FRA-2, FRA2FLJ23306 |
|---|
| Gene, Accession # | FOSL2, Gene ID: 2355, Accession: NP_005244, SwissProt: NP_005244 |
|---|
| Catalog # | H00002355-M03 |
|---|
| Price | |
|---|
| Order / More Info | FRA2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|