| Edit |   |
| Antigenic Specificity | PRAMEF10 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PRAMEF10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PRAMEF10. This antibody reacts with human. The PRAMEF10 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to PRAMEF10(PRAME family member 10) The peptide sequence was selected from the middle region of PRAMEF10. Peptide sequence DLLRHTGGLSKLGLELYPAPLESLDYKGHVNWEILTPIRAELMRTLREVR. |
| Other Names | MGC138413, MGC138415, PRAME family member 10, RP5-845O24.7 |
| Gene, Accession # | PRAMEF10, Gene ID: 343071, Accession: O60809, SwissProt: O60809 |
| Catalog # | NBP1-56432 |
| Price | |
| Order / More Info | PRAMEF10 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |