| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PPP3CB |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PPP3CB Antibody from Novus Biologicals is a rabbit polyclonal antibody to PPP3CB. This antibody reacts with human. The PPP3CB Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human PPP3CB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ADRVVKAVPFPPTHRLTSEEVFDLDGIPRVDVLKNHLVKEGRVDEEIALRIINEGAAILRREKTMIEVEAPITV |
|---|
| Other Names | Calmodulin-dependent calcineurin A subunit beta isoform, CALNA2protein phosphatase 3 (formerly 2B), catalytic subunit, beta isoform(calcineurin A beta), CAM-PRP catalytic subunit, CNA2catalytic subunit, beta isoform, EC 3.1.3.16, protein phosphatase 2B, catalytic subunit, beta isoform, protein phosphatase 3, catalytic subunit, beta isozyme, protein phosphatase from PCR fragment H32, serine/threonine-protein phosphatase 2B catalytic subunit beta isoform |
|---|
| Gene, Accession # | PPP3CB, Gene ID: 5532 |
|---|
| Catalog # | NBP2-58920 |
|---|
| Price | |
|---|
| Order / More Info | PPP3CB Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|