| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PPP3CB |
|---|
| Clone | 5D3 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, RNA Inhibition. Antibody reactivity against recombinant protein for WB. It has been used for RNAi Validation and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PPP3CB Antibody (5D3) from Novus Biologicals is a mouse monoclonal antibody to PPP3CB. This antibody reacts with human. The PPP3CB Antibody (5D3) has been validated for the following applications: Western Blot, ELISA, RNA Inhibition. |
|---|
| Immunogen | PPP3CB (NP_066955 435 a.a. - 524 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHTAQ |
|---|
| Other Names | Calmodulin-dependent calcineurin A subunit beta isoform, CALNA2protein phosphatase 3 (formerly 2B), catalytic subunit, beta isoform(calcineurin A beta), CAM-PRP catalytic subunit, CNA2catalytic subunit, beta isoform, EC 3.1.3.16, protein phosphatase 2B, catalytic subunit, beta isoform, protein phosphatase 3, catalytic subunit, beta isozyme, protein phosphatase from PCR fragment H32, serine/threonine-protein phosphatase 2B catalytic subunit beta isoform |
|---|
| Gene, Accession # | PPP3CB, Gene ID: 5532, Accession: NP_066955, SwissProt: NP_066955 |
|---|
| Catalog # | H00005532-M01 |
|---|
| Price | |
|---|
| Order / More Info | PPP3CB Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|