| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PPP3CC |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PPP3CC Antibody from Novus Biologicals is a rabbit polyclonal antibody to PPP3CC. This antibody reacts with human. The PPP3CC Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PPP3CC antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RGFSLQHKIRSFEEARGLDRINERMPPRKDSIHAGGPMKSVTSAHSHAAHRSDQGKKAHS |
|---|
| Other Names | Calcineurin, testis-specific catalytic subunit, Calmodulin-dependent calcineurin A subunit gamma isoform, CALNA3CAM-PRP catalytic subunit, CNA3, EC 3.1.3.16, PP2Bgamma, protein phosphatase 2B, catalytic subunit, gamma isoform, protein phosphatase 3 (formerly 2B), catalytic subunit, gamma isoform, protein phosphatase 3 (formerly 2B), catalytic subunit, gamma isoform(calcineurin A gamma), protein phosphatase 3, catalytic subunit, gamma isozyme, serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform |
|---|
| Gene, Accession # | PPP3CC, Gene ID: 5533 |
|---|
| Catalog # | NBP1-86656 |
|---|
| Price | |
|---|
| Order / More Info | PPP3CC Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|