| Edit |   |
|---|
| Antigenic Specificity | PPP5D1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. Recommended conditions for IHC,Retrieval method: HIER pH6 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PPP5D1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PPP5D1. This antibody reacts with human. The PPP5D1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AEMRAWRPLVRPSLQCVKLGRATARWWWVVKVKPHD |
|---|
| Other Names | PPP5 Tetratricopeptide Repeat Domain Containing 1, PPP5 TPR Repeat Domain-Containing Protein 1 |
|---|
| Gene, Accession # | PPP5D1, Gene ID: 100506012 |
|---|
| Catalog # | NBP2-68950 |
|---|
| Price | |
|---|
| Order / More Info | PPP5D1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|