| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PP4/PPP4C |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PP4/PPP4C Antibody from Novus Biologicals is a rabbit polyclonal antibody to PP4/PPP4C. This antibody reacts with human. The PP4/PPP4C Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PPP4C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MAEISDLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVT VCG |
|---|
| Other Names | EC 3.1.3.16, PP4C, PP4protein phosphatase X, catalytic subunit, PP-X, PPXPPH3, protein phosphatase 4 (formerly X), catalytic subunit, protein phosphatase 4, catalytic subunit, Protein phosphatase X |
|---|
| Gene, Accession # | PPP4C, Gene ID: 5531 |
|---|
| Catalog # | NBP2-13802 |
|---|
| Price | |
|---|
| Order / More Info | PP4/PPP4C Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|