| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ZNF354B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZNF354B Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF354B. This antibody reacts with human. The ZNF354B Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ZNF354B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CKSTPKMTKSTQTQDSFQEQIRKRLKRDEPWNFISERSCIYEEKLKKQQDKNENLQIISVAHTKILTVDRSHKNVEFGQNFYLKSVFIKQ |
|---|
| Other Names | G0/G1 switch regulatory protein 24, G0S24tristetraprolin, Growth factor-inducible nuclear protein NUP475, NUP475, Protein TIS11A, RNF162Atristetraproline, TIS11A, TIS11zfp-36, TTPGOS24, Zfp-36, Zinc finger protein 36 homolog, zinc finger protein 36, C3H type, homolog (mouse), zinc finger protein, C3H type, 36 homolog, zinc finger protein, C3H type, 36 homolog (mouse) |
|---|
| Gene, Accession # | ZNF354B, Gene ID: 117608 |
|---|
| Catalog # | NBP1-82064 |
|---|
| Price | |
|---|
| Order / More Info | ZNF354B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|