| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ZNF385B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZNF385B Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF385B. This antibody reacts with human. The ZNF385B Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human ZNF385B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GSKHAKKVKALDATKNKPKMVPSKDSAKANPSCSITPITGNNSDKSEDKGKLKASSSSQP |
|---|
| Other Names | C2H2-like zinc finger protein rearranged in thyroid adenomas, DKFZp686L0787, KRAB zinc finger protein, zinc finger protein 331, Zinc finger protein 463, ZNF463RITAZNF361Zinc finger protein 361 |
|---|
| Gene, Accession # | ZNF385B, Gene ID: 151126 |
|---|
| Catalog # | NBP2-58807 |
|---|
| Price | |
|---|
| Order / More Info | ZNF385B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|