| Edit |   |
|---|
| Antigenic Specificity | ZNF385D |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZNF385D Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF385D. This antibody reacts with human. The ZNF385D Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the C terminal of human ZNF385DThe immunogen for this antibody is ZNF385D. Peptide sequence RHKDRAAGKPPKPKYSPYNKLQKTAHPLGVKLVFSKEPSKPLAPRILPNP. |
|---|
| Other Names | FLJ12586, zinc finger protein 329 |
|---|
| Gene, Accession # | ZNF385D, Gene ID: 79750, Accession: NP_078973, SwissProt: NP_078973 |
|---|
| Catalog # | NBP1-79398-20ul |
|---|
| Price | |
|---|
| Order / More Info | ZNF385D Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|