| Edit |   |
| Antigenic Specificity | ZNF705D |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZNF705D Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF705D. This antibody reacts with human. The ZNF705D Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human LOC728957. Peptide sequence LGQKCYECDKSGKAFSQSSGFRGNKIIHIGEKPHACLLCGKAFSLSSDLR. |
| Other Names | MGC131746, putative zinc finger protein 705C, zinc finger protein 705C, zinc finger protein 705D, ZNF705C |
| Gene, Accession # | ZNF705D, Gene ID: 728957, Accession: NP_001034704, SwissProt: NP_001034704 |
| Catalog # | NBP1-79367-20ul |
| Price | |
| Order / More Info | ZNF705D Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |