| Edit |   |
| Antigenic Specificity | GRSF1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, bovine, mouse, rat, porcine |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-GRSF1 Antibody |
| Immunogen | The immunogen for anti-GRSF1 antibody: synthetic peptide directed towards the N terminal of human GRSF1. Synthetic peptide located within the following region: SCRRTGAACLPFYSAASYPALRASLLPQSLAAAAAVPTRSYSQESKTTYL |
| Other Names | G-rich RNA sequence binding factor 1 |
| Gene, Accession # | GRSF1, Accession: NM_002092 |
| Catalog # | TA345788 |
| Price | |
| Order / More Info | GRSF1 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |