| Edit |   |
|---|
| Antigenic Specificity | Poly (ADP-Ribose) Polymerase Family, Member 16 (PARP16) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Poly(ADP-ribosyl)ation is an immediate DNA-damage-dependent post-translational modification of histones and other nuclear proteins that contributes to the survival of injured proliferating cells. PARP16 is a member of poly(ADP-ribose) polymerases (PARPs) family that is encoded by different genes and displaying a conserved catalytic domain in which PARP-1 (113 kDa), the founding member, and PARP-2 (62 kDa) are so far the sole enzymes whose catalytic activity has been shown to be immediately stimulated by DNA strand breaks. |
|---|
| Immunogen | PARP16 antibody was raised using a synthetic peptide corresponding to a region with amino acids PKYFVVTNNQLLRVKYLLVYSQKPPKSRASSQLSWFSSHWFTVMISLYLL |
|---|
| Other Names | PARP16|zgc:77744|ARTD15|C15orf30|pART15|BC055447|C79952|PARP-16|LRRGT00109|RGD1306243 |
|---|
| Gene, Accession # | Gene ID: 54956 |
|---|
| Catalog # | ABIN634850 |
|---|
| Price | |
|---|
| Order / More Info | Poly (ADP-Ribose) Polymerase Family, Member 16 (PARP16) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|