Edit |   |
Antigenic Specificity | ARP3 Actin-Related Protein 3 Homolog B (Yeast) (ACTR3B) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | ACTR3B may function as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. ACTR3B may decrease the metastatic potential of tumors. |
Immunogen | ACTR3 B antibody was raised using a synthetic peptide corresponding to a region with amino acids MAGSLPPCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRR |
Other Names | RGD1565759|ARP11|ARP3BETA|9630005C02|AW047569|Arp3b|Arp3beta |
Gene, Accession # | Gene ID: 57180 |
Catalog # | ABIN632130 |
Price | |
Order / More Info | ARP3 Actin-Related Protein 3 Homolog B (Yeast) (ACTR3B) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |