| Edit |   |
|---|
| Antigenic Specificity | ARP2 Actin-Related Protein 2 Homolog (Yeast) (ACTR2) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | ACTR2 is known to be a major constituent of the ARP2/3 complex. This complex is located at the cell surface and is essential to cell shape and motility through lamellipodial actin assembly and protrusion. The specific function of this gene has not yet been determined. |
|---|
| Immunogen | ACTR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMVFLGGAVLADIMKDK |
|---|
| Other Names | ACTR2|actr2|hm:zeh1257|zgc:63719|arp2|ARP2|DKFZp459N093|ACTRT2|ACTIN RELATED PROTEIN 2|ATARP2|WRM|WURM|actin related protein 2|4921510D23Rik|AA409782|Arp2|D6Ertd746e|actr2-A|arp2-A|zgc:110550 |
|---|
| Gene, Accession # | Gene ID: 10097,66713,289820 |
|---|
| Catalog # | ABIN631175 |
|---|
| Price | |
|---|
| Order / More Info | ARP2 Actin-Related Protein 2 Homolog (Yeast) (ACTR2) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|