| Edit |   |
|---|
| Antigenic Specificity | Carboxylesterase 1 (CES1) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | CES1 is one of the enzymes responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters. This enzyme is known to hydrolyze aromatic and aliphatic esters and is necessary for cellular cholesterol esterification. |
|---|
| Immunogen | Carboxylesterase 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLGKFVSLEGFAQPVAIFLGIPFAKPPLGPLRFTPPQPAEPWSFVKNATS |
|---|
| Other Names | Es1|Es2|CES1|CES-K1|ACAT|CE-1|CEH|CES2|HMSE|HMSE1|PCE-1|REH|SES1|TGH|hCE-1|CESDD1|APLE|PMPMEase|Ces1|Es22|Ces-1|Ses-1 |
|---|
| Gene, Accession # | Gene ID: 1066 |
|---|
| Catalog # | ABIN629786 |
|---|
| Price | |
|---|
| Order / More Info | Carboxylesterase 1 (CES1) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|