Edit |   |
Antigenic Specificity | Ribosomal Protein L10a (RPL10A) (N-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L1P family of ribosomal proteins. It is located in the cytoplasm. The expression of this gene is downregulated in the thymus by cyclosporin-A (CsA), an immunosuppressive drug. Studies in mice have shown that the expression of the ribosomal protein L10a gene is downregulated in neural precursor cells during development. |
Immunogen | RPL10 A antibody was raised using the N terminal of RPL10 corresponding to a region with amino acids MSSKVSRDTLYEAVREVLHGNQRKRRKFLETVELQISLKNYDPQKDKRFS |
Other Names | Csa-19|L10A|NEDD6|CsA-19|Nedd6|wu:fb94f08|zgc:73082|zgc:86881 |
Gene, Accession # | Gene ID: 4736 |
Catalog # | ABIN631884 |
Price | |
Order / More Info | Ribosomal Protein L10a (RPL10A) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |