| Edit |   |
|---|
| Antigenic Specificity | Capping Protein (Actin Filament) Muscle Z-Line, alpha 3 (CAPZA3) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | F-actin-capping proteins bind in a Ca2+-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments. CAPZA3 may play a role in the morphogenesis of spermatid. |
|---|
| Immunogen | CAPZA3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MTLSVLSRKDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKLMHHQGEC |
|---|
| Other Names | CAPZA3|CAPPA3|Gsg3|510-4|Cappa3|Tex8|repro32 |
|---|
| Gene, Accession # | Gene ID: 93661 |
|---|
| Catalog # | ABIN631921 |
|---|
| Price | |
|---|
| Order / More Info | Capping Protein (Actin Filament) Muscle Z-Line, alpha 3 (CAPZA3) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|