| Edit |   |
| Antigenic Specificity | Calcium Homeostasis Endoplasmic Reticulum Protein (CHERP) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | CHERP is involved in calcium homeostasis, growth and proliferation. |
| Immunogen | CHERP antibody was raised using the middle region of CHERP corresponding to a region with amino acids EQGIQDPIKGGDVRDKWDQYKGVGVALDDPYENYRRNKSYSFIARMKARD |
| Other Names | cherp|MGC53695|CHERP|DAN16|SCAF6|SRA1|ik:tdsubc_2h12|scaf6|wu:fc83d01|xx:tdsubc_2h12|zgc:55518|5730408I11Rik|D8Wsu96e|Scaf6 |
| Gene, Accession # | Gene ID: 10523,27967,290614 |
| Catalog # | ABIN633834 |
| Price | |
| Order / More Info | Calcium Homeostasis Endoplasmic Reticulum Protein (CHERP) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |