| Edit |   |
|---|
| Antigenic Specificity | delta-Like 4 (DLL4) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Notch ligands family members are characterized by a DSL domain, EGF repeats, and a transmembrane domain. DLL4 plays a role in the Notch signaling pathway. IT activates Notch-1 and Notch-4. |
|---|
| Immunogen | DLL4 antibody was raised using a synthetic peptide corresponding to a region with amino acids QGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYYGDNCSRLCKKRNDHF |
|---|
| Other Names | hdelta2|Delta4|si:ch211-244p18.5|zgc:136596 |
|---|
| Gene, Accession # | Gene ID: 54567 |
|---|
| Catalog # | ABIN635181 |
|---|
| Price | |
|---|
| Order / More Info | delta-Like 4 (DLL4) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|