Edit |   |
Antigenic Specificity | Chromosome 5 Open Reading Frame 39 (C5orf39) (N-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | C5orf39 may act as a receptor for annexin II on marrow stromal cells to induce osteoclast formation. |
Immunogen | C5 ORF39 antibody was raised using the N terminal Of C5 rf39 corresponding to a region with amino acids EQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDS |
Other Names | AX2R|AXIIR|C5orf39 |
Gene, Accession # | Gene ID: 389289 |
Catalog # | ABIN630761 |
Price | |
Order / More Info | Chromosome 5 Open Reading Frame 39 (C5orf39) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |