| Edit |   |
|---|
| Antigenic Specificity | Chromosome 5 Open Reading Frame 4 (C5orf4) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, dog |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | C5ORF4 is involved in the fatty acid biosynthetic process. |
|---|
| Immunogen | C5 ORF4 antibody was raised using the N terminal Of C5 rf4 corresponding to a region with amino acids MKGEAGHMLHNEKSKQEGHIWGSMRRTAFILGSGLLSFVAFWNSVTWHLQ |
|---|
| Other Names | C5orf4|FAXDC2|c5orf4 |
|---|
| Gene, Accession # | Gene ID: 10826 |
|---|
| Catalog # | ABIN635643 |
|---|
| Price | |
|---|
| Order / More Info | Chromosome 5 Open Reading Frame 4 (C5orf4) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|