Edit |   |
Antigenic Specificity | Chromosome 6 Open Reading Frame 134 (C6orf134) (N-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The function of C6orf134 protein has not been widely studied, and is yet to be fully elucidated. |
Immunogen | C6 orf134 antibody was raised using the N terminal of C6 rf134 corresponding to a region with amino acids MEFPFDVDALFPERITVLDQHLRPPARRPGTTTPARVDLQQQIMTIIDEL |
Other Names | C23H6orf134|C6orf134|MEC17|Nbla00487|TAT|3110080J08Rik|Mec17|RGD1303066|0610011P08Rik|2610008K08Rik|2610110G12Rik|C7H6ORF134|Alpha-TAT|c6orf134|mec17|C4H6orf134|wu:fj19c03|zgc:65893|zgc:77443 |
Gene, Accession # | Gene ID: 79969 |
Catalog # | ABIN632487 |
Price | |
Order / More Info | Chromosome 6 Open Reading Frame 134 (C6orf134) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |