| Edit |   |
|---|
| Antigenic Specificity | Chromosome 6 Open Reading Frame 154 (C6orf154) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The function of Chromosome 6 ORF protein is not widely studied, and is yet to be elucidated fully. |
|---|
| Immunogen | C6 orf154 antibody was raised using the N terminal of C6 rf154 corresponding to a region with amino acids MLPSSIQISGEPLSGAEVRDICRGLRDNAVRLLSLRGCRLCDRDFGRICR |
|---|
| Other Names | C6orf154|LRRC73|nod3l |
|---|
| Gene, Accession # | Gene ID: 221424 |
|---|
| Catalog # | ABIN633006 |
|---|
| Price | |
|---|
| Order / More Info | Chromosome 6 Open Reading Frame 154 (C6orf154) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|