| Edit |   |
|---|
| Antigenic Specificity | Chromosome 6 Open Reading Frame 192 (C6orf192) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | This gene encodes a protein, which has high sequence similarity to rat, xenopus and zebrafish proteins. The protein function is unknown. |
|---|
| Immunogen | C6 ORF192 antibody was raised using the N terminal Of C6 rf192 corresponding to a region with amino acids ISAASVNLGSMMCYSILGPFFPKEAEKKGASNTIIGMIFGCFALFELLAS |
|---|
| Other Names | C3H6orf192|SLC18B1|C6orf192|dJ55C23.6|1110021L09Rik |
|---|
| Gene, Accession # | Gene ID: 116843 |
|---|
| Catalog # | ABIN635175 |
|---|
| Price | |
|---|
| Order / More Info | Chromosome 6 Open Reading Frame 192 (C6orf192) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|