| Edit |   |
|---|
| Antigenic Specificity | Chromosome 6 Open Reading Frame 25 (C6orf25) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | This gene is a member of the immunoglobulin (Ig) superfamily and is located in the major histocompatibility complex (MHC) class III region. The protein encoded by this gene is a glycosylated, plasma membrane-bound cell surface receptor, but soluble isoforms encoded by some transcript variants have been found in the endoplasmic reticulum and Golgi before being secreted. Multiple transcript variants encoding different isoforms have been found for this gene. |
|---|
| Immunogen | C6 ORF25 antibody was raised using the N terminal Of C6 rf25 corresponding to a region with amino acids AVFLQLLPLLLSRAQGNPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFP |
|---|
| Other Names | G6b|Ng31|C6orf25|NG31|LOC745085|G6B |
|---|
| Gene, Accession # | Gene ID: 80739 |
|---|
| Catalog # | ABIN635805 |
|---|
| Price | |
|---|
| Order / More Info | Chromosome 6 Open Reading Frame 25 (C6orf25) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|