Edit |   |
Antigenic Specificity | Chromosome X Open Reading Frame 66 (CXorf66) (Middle Region) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The protein encoded by this gene is predicted to be a type I membrane protein, however, its exact function is not known. |
Immunogen | CXorf66 antibody was raised using the middle region of CXorf66 corresponding to a region with amino acids PLYSSHPQNEISPSKPFGPQELAKPPKHFNPKRSVSLGRAALLSNSELAE |
Other Names | n/a |
Gene, Accession # | Gene ID: 347487 |
Catalog # | ABIN635057 |
Price | |
Order / More Info | Chromosome X Open Reading Frame 66 (CXorf66) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |