| Edit |   |
| Antigenic Specificity | CLPB |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CLPB Antibody from Novus Biologicals is a rabbit polyclonal antibody to CLPB. This antibody reacts with human. The CLPB Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to CLPB(ClpB caseinolytic peptidase B homolog (E. coli)) The peptide sequence was selected from the middle region of CLPB. Peptide sequence ELIQLVNKELNFWAKRAKQRHNITLLWDREVADVLVDGYNVHYGARSIKH. |
| Other Names | caseinolytic peptidase B protein homolog, ClpB caseinolytic peptidase B homolog (E. coli), HSP78SKD3FLJ13152, Suppressor of potassium transport defect 3 |
| Gene, Accession # | CLPB, Gene ID: 81570, Accession: Q9H078, SwissProt: Q9H078 |
| Catalog # | NBP1-57703 |
| Price | |
| Order / More Info | CLPB Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |