| 产品详情 |
| Edit |   |
| Antigenic Specificity | Solute carrier family 22 member 18 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Solute carrier family 22 member 18 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Solute carrier family 22 member 18. This antibody reacts with human. The Solute carrier family 22 member 18 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to SLC22A18(solute carrier family 22, member 18) The peptide sequence was selected from the N terminal of SLC22A18. Peptide sequence AASSPALPGVYLLFASRLPGALMHTLPAAQMVITDLSAPEERPAALGRLG. |
| Other Names | BWR1AORCTL2, BWSCR1Asolute carrier family 22 (organic cation transporter), member 1-like, Efflux transporter-like protein, HET, imprinted multi-membrane spanning polyspecific transporter-related protein 1, Imprinted multi-membrane-spanning polyspecific transporter-related protein 1, IMPT1DKFZp667A184, ITMp45-BWR1A, ORCTL-2, organic cation transporter-like 2, Organic cation transporter-like protein 2, p45 Beckwith-Wiedemann region 1A, SLC22A1Lcandidate A, solute carrier family 22 member 18, Solute carrier family 22 member 1-like, solute carrier family 22, member 18, TSSC5p45-Beckwith-Wiedemann region 1 A, Tumor-suppressing STF cDNA 5 protein, Tumor-suppressing subchromosomal transferable fragment candidate gene 5 protein |
| Gene, Accession # | SLC22A18, Gene ID: 5002 |
| Catalog # | NBP1-59747 |
| Price | |
| Order / More Info | Solute carrier family 22 member 18 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|