| Edit |   |
|---|
| Antigenic Specificity | TAT |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TAT Antibody from Novus Biologicals is a rabbit polyclonal antibody to TAT. This antibody reacts with rat. The TAT Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is Tat. Peptide sequence PGLQPVRPSGAMYLMVGIEMEHFPEFENDVEFTERLIAEQAVHCLPATCF. |
|---|
| Other Names | EC 2.6.1.5, L-tyrosine:2-oxoglutarate aminotransferase, tyrosine aminotransferase, tyrosine aminotransferase, cytosolic |
|---|
| Gene, Accession # | TAT, Gene ID: 6898, Accession: NP_036800 |
|---|
| Catalog # | NBP1-79286-20ul |
|---|
| Price | |
|---|
| Order / More Info | TAT Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|