| 产品详情 |
| Edit |   |
| Antigenic Specificity | DHX32 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DHX32 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DHX32. This antibody reacts with human. The DHX32 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human DHX32 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EKGDIVVFLACEQDIEKVCETVYQGSNLNPDLGELVVVPLYPKEKCSLFK PLDETEKRCQVYQRRVVLTTSSGEFLIWSNSVRFVIDVGVERR |
| Other Names | DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 32, DEAD/H box 32, DEAD/H helicase-like protein 1, DEAH (Asp-Glu-Ala-His) box polypeptide 32, DEAH box protein 32, DHLP1DDX32DEAD/H helicase-like protein-1, EC 3.6.1, EC 3.6.4.13, FLJ10694, FLJ10889, huDDX32, putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32 |
| Gene, Accession # | DHX32, Gene ID: 55760 |
| Catalog # | NBP2-13921 |
| Price | |
| Order / More Info | DHX32 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|