| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DHX36 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DHX36 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DHX36. This antibody reacts with human. The DHX36 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human DHX36 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ERREEQIVQLLNSVQAKNDKESEAQISWFAPEDHGYGTEVSTKNTPCSENKLDIQEKKLINQEKKMFRIRNRSYIDRDSEYLLQENEPDGT |
|---|
| Other Names | DDX36, DEAH (Asp-Glu-Ala-His) box polypeptide 36, DEAH box protein 36, EC 3.6.1, EC 3.6.4.13, G4 resolvase-1, KIAA1488G4R1, MLEL1RHAUDEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 36, MLE-like protein 1, probable ATP-dependent RNA helicase DHX36, RNA helicase associated with AU-rich element ARE |
|---|
| Gene, Accession # | DHX36, Gene ID: 170506 |
|---|
| Catalog # | NBP1-84286 |
|---|
| Price | |
|---|
| Order / More Info | DHX36 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|