| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ADCY10 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ADCY10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ADCY10. This antibody reacts with human. The ADCY10 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ADCY10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NLENLVAQNTTGPVFCPRLYHLMAYVCILMGDGQKCGLFLNTALRLSETQGNILEKCWLNMNKESWYSTSELKEDQWLQTILSLPSW |
|---|
| Other Names | adenylate cyclase 10 (soluble), Adenylate cyclase homolog, adenylate cyclase type 10, AH-related protein, ATP pyrophosphate-lyase, EC 4.6.1.1, Germ cell soluble adenylyl cyclase, HCA2RP1-313L4.2, hsAC, sAC, SAC3'-5'-cyclic AMP synthetase, SACI, Sacy, Testicular soluble adenylyl cyclase, testicular soluble adenylyl cyclase (SAC) |
|---|
| Gene, Accession # | ADCY10, Gene ID: 55811 |
|---|
| Catalog # | NBP1-81766 |
|---|
| Price | |
|---|
| Order / More Info | ADCY10 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|