| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Hsp70 interacting protein HIP |
|---|
| Clone | 2B2 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Hsp70 interacting protein HIP Antibody (2B2) from Novus Biologicals is a mouse monoclonal antibody to Hsp70 interacting protein HIP. This antibody reacts with human. The Hsp70 interacting protein HIP Antibody (2B2) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | ST13 (AAH15317, 1 a.a. - 58 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MLFKSFKNTHHINLHLSLCVLLLMCRVLLSRNCQCVLGLTQEQFLLDSLFDLFNLIIF |
|---|
| Other Names | AAG2, aging-associated protein 2, FAM10A1FAM10A4, heat shock 70kD protein binding protein, Hip, HIPFLJ27260, HOP, hsc70-interacting protein, Hsp70-interacting protein, HSPABP1, P48MGC129952, PRO0786, Progesterone receptor-associated p48 protein, Protein FAM10A1, Putative tumor suppressor ST13, Renal carcinoma antigen NY-REN-33, SNC6HSPABP, suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein), suppression of tumorigenicity 13 (colon carcinoma) (Hsp70-interacting protein), Suppression of tumorigenicity 13 protein |
|---|
| Gene, Accession # | ST13, Gene ID: 6767, Accession: AAH15317, SwissProt: AAH15317 |
|---|
| Catalog # | H00006767-M02 |
|---|
| Price | |
|---|
| Order / More Info | Hsp70 interacting protein HIP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|