| Edit |   |
| Antigenic Specificity | Fructosamine-3-kinase-related |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Fructosamine-3-kinase-related Antibody from Novus Biologicals is a rabbit polyclonal antibody to Fructosamine-3-kinase-related. This antibody reacts with human. The Fructosamine-3-kinase-related Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to FN3KRP(fructosamine-3-kinase-related protein) The peptide sequence was selected from the N terminal of FN3KRP. Peptide sequence MDPGDPAGDPAAGERHRMGRDPLLLLQALQTLWSTRERKQLREEAWRGFA. |
| Other Names | EC 2.7.1.-, FLJ12171, FN3KL, FN3K-related protein, FN3K-RP, fructosamine 3 kinase related protein, Fructosamine-3-kinase-related protein, ketosamine-3-kinase |
| Gene, Accession # | FN3KRP, Gene ID: 79672, Accession: Q9HA64, SwissProt: Q9HA64 |
| Catalog # | NBP1-56367 |
| Price | |
| Order / More Info | Fructosamine-3-kinase-related Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |