| Edit |   |
|---|
| Antigenic Specificity | RASGEF1C |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RASGEF1C Antibody from Novus Biologicals is a rabbit polyclonal antibody to RASGEF1C. This antibody reacts with human. The RASGEF1C Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to RASGEF1C(RasGEF domain family, member 1C) The peptide sequence was selected from the middle region of RASGEF1C. Peptide sequence FLELAKQVGEFITWKQVECPFEQDASITHYLYTAPIFSEDGLYLASYESE. |
|---|
| Other Names | FLJ35841, RasGEF domain family, member 1C, ras-GEF domain-containing family member 1C |
|---|
| Gene, Accession # | RASGEF1C, Gene ID: 255426, Accession: Q8N431, SwissProt: Q8N431 |
|---|
| Catalog # | NBP1-58874 |
|---|
| Price | |
|---|
| Order / More Info | RASGEF1C Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|