| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLC22A2/OCT2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Single Cell Western. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Western Blot reactivity reported in scientific literature (PMID: 26045896) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC22A2/OCT2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC22A2/OCT2. This antibody reacts with human, rat. The SLC22A2/OCT2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Single Cell Western. Specificity of human, rat SLC22A2/OCT2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIR |
|---|
| Other Names | hOCT2, MGC32628, OCT2Organic cation transporter 2, solute carrier family 22 (organic cation transporter), member 2, solute carrier family 22 member 2 |
|---|
| Gene, Accession # | SLC22A2, Gene ID: 6582, Accession: O15244, SwissProt: O15244 |
|---|
| Catalog # | NBP1-89417 |
|---|
| Price | |
|---|
| Order / More Info | SLC22A2/OCT2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24887156, 26045896 |
|---|
| 产品资料 |
|
|