| 产品详情 |
| Edit |   |
|---|
| Product Name | PRKCBP1, Recombinant, Human, aa160-280, GST-tag |
|---|
| Description | Purified (~80%). The protein encoded by this gene is a receptor for activated C-kinase (RACK) protein. The encoded protein has been shown to bind in vitro to activated protein kinase C beta I. In addition, this protein is a cutaneous T-cell lymphoma-associated antigen. Finally, the protein contains a bromodomain and two zinc fingers, and is thought to be a transcriptional regulator. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]. Source: Recombinant protein corresponding to aa160-280 from human bromodomain PRKCBP1, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~41kD AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK VDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSETQSK AMTMLTIEQLSYLLKFAIQKMKQPGTDAFQKPVPLEQHPDYAEYIFHPMDLCTLEKNA KKKMYGCTE |
|---|
| Size | 100ug |
|---|
| Concentration | n/a |
|---|
| Applications | n/a |
|---|
| Other Names | PRKCBP1, Recombinant, Human, aa160-280, GST-tag (ZMYND8, Zinc Finger MYND-Type Containing 8, CTCL Tumor Antigen Se14-3, RACK7) |
|---|
| Gene, Accession, CAS # | Accession: NM_183047, SwissProt: Q9ULU4 |
|---|
| Catalog # | 298448 |
|---|
| Price | |
|---|
| Order / More Info | PRKCBP1, Recombinant, Human, aa160-280, GST-tag from UNITED STATES BIOLOGICAL |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|