| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ASNA1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ASNA1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ASNA1. This antibody reacts with human. The ASNA1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human ASNA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EPTLSNIIEQRSLKWIFVGGKGGVGKTTCSCSLAVQLSKGRESVLIISTDPAHNISDAFDQKFSKVPTKVKGYDNLFAMEIDPS |
|---|
| Other Names | ARSA, arsA arsenite transporter, ATP-binding, homolog 1 (bacterial), ARSA1, ARSA-I, Arsenical pump-driving ATPase, Arsenite-stimulated ATPase, ATPase ASNA1, EC 3.6, EC 3.6.3.16, GET3, golgi to ER traffic 3 homolog, hARSA-I, hASNA-I, MGC3821, Transmembrane domain recognition complex 40 kDa ATPase subunit, transmembrane domain recognition complex, 40kDa, TRC40arsA (bacterial) arsenite transporter, ATP-binding, homolog 1 |
|---|
| Gene, Accession # | ASNA1, Gene ID: 439 |
|---|
| Catalog # | NBP2-56050 |
|---|
| Price | |
|---|
| Order / More Info | ASNA1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|