| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | UBQLN4/CIP75 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The UBQLN4/CIP75 Antibody from Novus Biologicals is a rabbit polyclonal antibody to UBQLN4/CIP75. This antibody reacts with human. The UBQLN4/CIP75 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human UBQLN4/CIP75 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EGTGGSGTSQVHPTVSNPFGINAASLGSGMFNSPEMQALLQQISEN |
|---|
| Other Names | A1Uataxin-1 ubiquitin-like interacting protein, Ataxin-1 ubiquitin-like-interacting protein A1U, C1orf6ubiquilin-4, chromosome 1 open reading frame 6, UBINCIP75, ubiquilin 4 |
|---|
| Gene, Accession # | UBQLN4, Gene ID: 56893 |
|---|
| Catalog # | NBP2-49346 |
|---|
| Price | |
|---|
| Order / More Info | UBQLN4/CIP75 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|