| Edit |   |
|---|
| Antigenic Specificity | UBQLN4/CIP75 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The UBQLN4/CIP75 Antibody from Novus Biologicals is a rabbit polyclonal antibody to UBQLN4/CIP75. This antibody reacts with human. The UBQLN4/CIP75 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to UBQLN4/CIP75(ubiquilin 4) The peptide sequence was selected from the middle region of UBQLN4/CIP75. Peptide sequence TDIQEPMFSAAREQFGNNPFSSLAGNSDSSSSQPLRTENREPLPNPWSPS. |
|---|
| Other Names | A1Uataxin-1 ubiquitin-like interacting protein, Ataxin-1 ubiquitin-like-interacting protein A1U, C1orf6ubiquilin-4, chromosome 1 open reading frame 6, UBINCIP75, ubiquilin 4 |
|---|
| Gene, Accession # | UBQLN4, Gene ID: 56893, Accession: Q9NRR5, SwissProt: Q9NRR5 |
|---|
| Catalog # | NBP1-56383-20ul |
|---|
| Price | |
|---|
| Order / More Info | UBQLN4/CIP75 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|