| Edit |   |
|---|
| Antigenic Specificity | MTERFD2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MTERFD2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MTERFD2. This antibody reacts with mouse. The MTERFD2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is Mterfd2 - C-terminal region. Peptide sequence LERLGRYQTPDKKGQTQIPNPSLRNILRVSEAEFLARTACSSVEEFQVFK. |
|---|
| Other Names | FLJ16261, MGC61716, MTERF domain containing 2, mTERF domain-containing protein 2 |
|---|
| Gene, Accession # | MTERFD2, Gene ID: 130916, Accession: NP_835152 |
|---|
| Catalog # | NBP1-98416-20ul |
|---|
| Price | |
|---|
| Order / More Info | MTERFD2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|