| 产品详情 |
| Edit |   |
| Antigenic Specificity | COP9 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The COP9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to COP9. This antibody reacts with human. The COP9 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human COP9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LRGIGILKQAIDKMQMNTNQLTSIHADLCQLCLLAKCFKPALPYLDVDMMDICKENGAYDAKHFLCYYYYGGMIYTGLKNFERALYFYEQAITTPAM |
| Other Names | COP9 constitutive photomorphogenic homolog subunit 3 (Arabidopsis), COP9 signalosome complex subunit 3, CSN3COP9 complex subunit 3, JAB1-containing signalosome subunit 3, SGN3COP9 (constitutive photomorphogenic, Arabidopsis, homolog) subunit 3, Signalosome subunit 3 |
| Gene, Accession # | COPS3, Gene ID: 8533 |
| Catalog # | NBP2-55300 |
| Price | |
| Order / More Info | COP9 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|