| Edit |   |
| Antigenic Specificity | RAD23 Homolog B (S. Cerevisiae) (RAD23B) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The protein encoded by this gene is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in the nucleotide excision repair (NER). |
| Immunogen | RAD23 B antibody was raised using a synthetic peptide corresponding to a region with amino acids QMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAG |
| Other Names | MGC107846|HHR23B|HR23B|P58|zgc:65951|0610007D13Rik|AV001138|mHR23B|p58 |
| Gene, Accession # | Gene ID: 5887,19359,298012 |
| Catalog # | ABIN631882 |
| Price | |
| Order / More Info | RAD23 Homolog B (S. Cerevisiae) (RAD23B) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |